DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and ATG8E

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_182042.2 Gene:ATG8E / 819125 AraportID:AT2G45170 Length:122 Species:Arabidopsis thaliana


Alignment Length:116 Identity:69/116 - (59%)
Similarity:90/116 - (77%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIH 69
            :|.::.||||:||..:||.|||||:|||||||.|:.:.::||||||||||||||||.::|||||.
plant     7 FKMDNDFEKRKAEAGRIREKYPDRIPVIVEKAEKSEVPNIDKKKYLVPSDLTVGQFVYVIRKRIK 71

  Fly    70 LRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGMAKI 120
            |..|.|:|.||:||:|||...|.|:|::..:||.||||.||.||.:|.:.|
plant    72 LSAEKAIFIFVDNVLPPTGELMSSVYEDKKDEDGFLYITYSGENTFGASSI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 67/110 (61%)
ATG8ENP_182042.2 Ubl_ATG8 13..115 CDD:340545 64/101 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1480
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1674
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - mtm1018
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.