DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and ATG8D

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001154497.1 Gene:ATG8D / 815112 AraportID:AT2G05630 Length:164 Species:Arabidopsis thaliana


Alignment Length:108 Identity:63/108 - (58%)
Similarity:89/108 - (82%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPED 74
            :.:||:||..:||.|||||:|||||:|.|:.:.|:|:||||||:|||||||.:::||||.|.||.
plant    55 SLKKRQAEAARIREKYPDRIPVIVERAEKSDVPDIDRKKYLVPADLTVGQFVYVVRKRIKLSPEK 119

  Fly    75 ALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117
            |:|.||.|::|||:|.|.::|:||.:||.|||::||.||.:|:
plant   120 AIFIFVKNILPPTAAIMSAIYEEHKDEDGFLYMSYSGENTFGI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 62/105 (59%)
ATG8DNP_001154497.1 GABARAP 55..161 CDD:176355 62/105 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1480
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134420
Inparanoid 1 1.050 155 1.000 Inparanoid score I1674
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - mtm1018
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.