DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and Map1lc3b

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001351287.1 Gene:Map1lc3b / 67443 MGIID:1914693 Length:160 Species:Mus musculus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:66/155 - (42%) Gaps:45/155 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGD-------------------------- 43
            :|:..:||:|..:...||.::|.::||   .:|.|| ||                          
Mouse     7 FKQRRSFEQRVEDVRLIREQHPTKIPV---GSPAAR-GDPNPIGAPRSPGKPQAPDLSRGKRGRR 67

  Fly    44 --------------LDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVN-NVIPPTSATMGS 93
                          |||.|:|||..:.:.:...:||:|:.|....|.|..|| :.:...|..:..
Mouse    68 VIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISE 132

  Fly    94 LYQEHHEEDYFLYIAYSDENVYGMA 118
            :|:...:||.|||:.|:.:..:|.|
Mouse   133 VYESERDEDGFLYMVYASQETFGTA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 37/151 (25%)
Map1lc3bNP_001351287.1 GABARAP 7..155 CDD:176355 37/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.