DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and Map1lc3a

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_080011.1 Gene:Map1lc3a / 66734 MGIID:1915661 Length:121 Species:Mus musculus


Alignment Length:114 Identity:36/114 - (31%)
Similarity:67/114 - (58%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEK-APKARIGDLDKKKYLVPSDLTVGQFYFLIRKRI 68
            :|:..:|..|..|..:||.::|.::|||:|: ..:.::..|||.|:|||..:.:.:...:||:|:
Mouse     7 FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRL 71

  Fly    69 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            .|.|..|.|..|| :.:...|..:..:|::..:||.|||:.|:.:..:|
Mouse    72 QLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 35/112 (31%)
Map1lc3aNP_080011.1 Ubl_ATG8_MAP1LC3A 4..120 CDD:340754 35/112 (31%)
Important for interaction with ATG13 and for autophagosome formation. /evidence=ECO:0000250|UniProtKB:Q9H492 49..53 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.