DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and Gabarap

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_062723.1 Gene:Gabarap / 56486 MGIID:1861742 Length:117 Species:Mus musculus


Alignment Length:117 Identity:107/117 - (91%)
Similarity:113/117 - (96%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            |||.|||||.|||||:||:|||:||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65

  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117
            ||||||.||||||||||||||||||||.|||||||||:|||||||||:|||:
Mouse    66 KRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 102/110 (93%)
GabarapNP_062723.1 Interaction with beta-tubulin. /evidence=ECO:0000269|PubMed:10899939 1..22 16/20 (80%)
Ubl_ATG8_GABARAP 2..116 CDD:340752 104/113 (92%)
Interaction with GPHN. /evidence=ECO:0000269|PubMed:10900017 36..117 76/80 (95%)
Interaction with GABRG2. /evidence=ECO:0000250|UniProtKB:O95166 36..68 31/31 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 204 1.000 Domainoid score I2946
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3497
Isobase 1 0.950 - 0 Normalized mean entropy S125
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - oto92602
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - LDO PTHR10969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2039
SonicParanoid 1 1.000 - - X355
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.