DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and ctdnep1

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001017177.1 Gene:ctdnep1 / 549931 XenbaseID:XB-GENE-5939296 Length:244 Species:Xenopus tropicalis


Alignment Length:94 Identity:17/94 - (18%)
Similarity:29/94 - (30%) Gaps:45/94 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PDRV-PVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSA 89
            ||.: .|:::|.|                          :|..:|.||.  :.||:..|      
 Frog    91 PDFILKVVIDKHP--------------------------VRFFVHKRPH--VDFFLEVV------ 121

  Fly    90 TMGSLYQEHHEEDYFLYIAYSDENVYGMA 118
                      .:.|.|.:..:...:||.|
 Frog   122 ----------SQWYELVVFTASMEIYGSA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 14/90 (16%)
ctdnep1NP_001017177.1 HIF-SF_euk 61..229 CDD:274055 17/94 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 204 1.000 Domainoid score I2882
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.