powered by:
Protein Alignment Atg8a and ctdnep1
DIOPT Version :9
Sequence 1: | NP_727447.1 |
Gene: | Atg8a / 32001 |
FlyBaseID: | FBgn0052672 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017177.1 |
Gene: | ctdnep1 / 549931 |
XenbaseID: | XB-GENE-5939296 |
Length: | 244 |
Species: | Xenopus tropicalis |
Alignment Length: | 94 |
Identity: | 17/94 - (18%) |
Similarity: | 29/94 - (30%) |
Gaps: | 45/94 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 PDRV-PVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSA 89
||.: .|:::|.| :|..:|.||. :.||:..|
Frog 91 PDFILKVVIDKHP--------------------------VRFFVHKRPH--VDFFLEVV------ 121
Fly 90 TMGSLYQEHHEEDYFLYIAYSDENVYGMA 118
.:.|.|.:..:...:||.|
Frog 122 ----------SQWYELVVFTASMEIYGSA 140
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
204 |
1.000 |
Domainoid score |
I2882 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.