DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and myo1a

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001008063.1 Gene:myo1a / 493425 XenbaseID:XB-GENE-979281 Length:1073 Species:Xenopus tropicalis


Alignment Length:145 Identity:32/145 - (22%)
Similarity:52/145 - (35%) Gaps:35/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QYKEEHAFEKRRAEGDK--IRRKYPD---RVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF--- 60
            ::|....|:.:..:.||  .....||   |:.....:......|.|||...|:..||:...:   
 Frog   479 KFKNHKHFQSKVTQNDKRIADLTLPDNCFRIEHYAGQVTYNTDGFLDKNNDLLFRDLSQAMWNAK 543

  Fly    61 YFLIR--------KRIHL-RPEDALFFFVNNV-----------------IPPTSATMGSLYQEHH 99
            :.|::        |...| ||....|.|.|:|                 :.|.|:...||:.:..
 Frog   544 HQLLKTLFPEGDPKNSSLKRPPTVGFQFRNSVSTLMKNLYAKNPNYIRCLKPNSSKKPSLFDDVL 608

  Fly   100 EEDYFLYIAYSDENV 114
            .:...||:... |||
 Frog   609 VKTQILYLGLL-ENV 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 32/144 (22%)
myo1aNP_001008063.1 MYSc_Myo1 31..685 CDD:276829 32/145 (22%)
Myosin_TH1 880..1073 CDD:399188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.