DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and MAP1LC3C

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001004343.1 Gene:MAP1LC3C / 440738 HGNCID:13353 Length:147 Species:Homo sapiens


Alignment Length:114 Identity:43/114 - (37%)
Similarity:73/114 - (64%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRI 68
            :|:..:...|:.|...||.|:|:::||:||:.|:.. :..|||.|:|||.:||:.||..:||.|:
Human    13 FKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRM 77

  Fly    69 HLRPEDALFFFVNN-VIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            .||..:|.:..||| .:...||||..:|:::.:||.|:|:.|:.:..:|
Human    78 VLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 42/112 (38%)
MAP1LC3CNP_001004343.1 GABARAP 13..126 CDD:176355 42/112 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S125
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.