DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and Map1lc3a

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_955794.1 Gene:Map1lc3a / 362245 RGDID:735183 Length:121 Species:Rattus norvegicus


Alignment Length:114 Identity:36/114 - (31%)
Similarity:67/114 - (58%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEK-APKARIGDLDKKKYLVPSDLTVGQFYFLIRKRI 68
            :|:..:|..|..|..:||.::|.::|||:|: ..:.::..|||.|:|||..:.:.:...:||:|:
  Rat     7 FKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRL 71

  Fly    69 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            .|.|..|.|..|| :.:...|..:..:|::..:||.|||:.|:.:..:|
  Rat    72 QLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 35/112 (31%)
Map1lc3aNP_955794.1 Ubl_ATG8_MAP1LC3A 4..120 CDD:340754 35/112 (31%)
Important for interaction with ATG13 and for autophagosome formation. /evidence=ECO:0000250|UniProtKB:Q9H492 49..53 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.