DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and FMN1

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001264242.1 Gene:FMN1 / 342184 HGNCID:3768 Length:1419 Species:Homo sapiens


Alignment Length:105 Identity:27/105 - (25%)
Similarity:47/105 - (44%) Gaps:22/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKAR--IGDLDKKKYLVPSDLTVGQFYFLIRKRIHL 70
            |:.|.|...:    ::|.|  :....||..|.:  |..||.|:     ..|||    ::...:||
Human  1019 EYLFSKDTTQ----QKKKP--LSETYEKKNKVKKIIKLLDGKR-----SQTVG----ILISSLHL 1068

  Fly    71 RPED---ALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYI 107
            ..:|   |:|...::|:  ...|:.:||:...:||..:.|
Human  1069 EMKDIQQAIFNVDDSVV--DLETLAALYENRAQEDELVKI 1106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 27/105 (26%)
FMN1NP_001264242.1 Microtubule-binding. /evidence=ECO:0000250 1..622
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..194
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..331
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..641
Mediates interaction with alpha-catenin. /evidence=ECO:0000250 456..842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..711
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 859..978
FH2 973..1370 CDD:214697 27/105 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1390..1419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.