DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and map1lc3b

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_955898.1 Gene:map1lc3b / 322425 ZFINID:ZDB-GENE-030131-1145 Length:122 Species:Danio rerio


Alignment Length:114 Identity:35/114 - (30%)
Similarity:66/114 - (57%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEK-APKARIGDLDKKKYLVPSDLTVGQFYFLIRKRI 68
            :|:...||:|..:...||.::|:::|||:|: ..:.::..|||.|:|||..:.:.:...:||:|:
Zfish     7 FKQRRTFEQRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIRRRL 71

  Fly    69 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            .|....|.|..|| :.:...|..:..:|:...:||.|||:.|:.:..:|
Zfish    72 QLNSNQAFFLLVNGHSMVSVSTAISEVYERERDEDGFLYMVYASQETFG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 34/112 (30%)
map1lc3bNP_955898.1 GABARAP 7..120 CDD:176355 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.