DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and GABARAPL1

DIOPT Version :10

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001350527.1 Gene:GABARAPL1 / 23710 HGNCID:4068 Length:146 Species:Homo sapiens


Alignment Length:96 Identity:83/96 - (86%)
Similarity:90/96 - (93%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            |||||||:|.||.|:.||:|||:|||||||||||||||||:.||||:||||||||||||||||||
Human     1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIR 65

  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQ 96
            |||||||||||||||||.|||||||||.||:
Human    66 KRIHLRPEDALFFFVNNTIPPTSATMGQLYE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 Ubl_ATG8_GABARAP 2..116 CDD:340752 82/95 (86%)
GABARAPL1NP_001350527.1 Ubl1_cv_Nsp3_N-like 5..96 CDD:475130 78/90 (87%)

Return to query results.
Submit another query.