DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and GABARAPL1

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001350527.1 Gene:GABARAPL1 / 23710 HGNCID:4068 Length:146 Species:Homo sapiens


Alignment Length:96 Identity:83/96 - (86%)
Similarity:90/96 - (93%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            |||||||:|.||.|:.||:|||:|||||||||||||||||:.||||:||||||||||||||||||
Human     1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIR 65

  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQ 96
            |||||||||||||||||.|||||||||.||:
Human    66 KRIHLRPEDALFFFVNNTIPPTSATMGQLYE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 79/92 (86%)
GABARAPL1NP_001350527.1 Ubiquitin_like_fold 5..96 CDD:391949 78/90 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134420
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2039
SonicParanoid 1 1.000 - - X355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.