DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and lgg-1

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_495277.1 Gene:lgg-1 / 174050 WormBaseID:WBGene00002980 Length:123 Species:Caenorhabditis elegans


Alignment Length:116 Identity:99/116 - (85%)
Similarity:107/116 - (92%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            ||:.||||:.||||||||||||||||||:|||||||||:::.|||||||||||||||||||||||
 Worm     1 MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIR 65

  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            |||.||||||||||||||||.|..|||.|||:|||||.|||||||||:|||
 Worm    66 KRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 95/110 (86%)
lgg-1NP_495277.1 GABARAP 5..116 CDD:176355 95/110 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 192 1.000 Domainoid score I1896
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134420
Inparanoid 1 1.050 208 1.000 Inparanoid score I2394
Isobase 1 0.950 - 0 Normalized mean entropy S125
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - oto20801
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - LDO PTHR10969
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2039
SonicParanoid 1 1.000 - - X355
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.860

Return to query results.
Submit another query.