DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and AgaP_AGAP002685

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:XP_312238.3 Gene:AgaP_AGAP002685 / 1273277 VectorBaseID:AGAP002685 Length:130 Species:Anopheles gambiae


Alignment Length:116 Identity:112/116 - (96%)
Similarity:113/116 - (97%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            |||||||||.||||:||||||||||||||||||||||||||.|||||||||||||||||||||||
Mosquito     1 MKFQYKEEHPFEKRKAEGDKIRRKYPDRVPVIVEKAPKARIDDLDKKKYLVPSDLTVGQFYFLIR 65

  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            ||||||||||||||||||||||||||||||.||||||||||||||||||||
Mosquito    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYHEHHEEDYFLYIAYSDENVYG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 106/110 (96%)
AgaP_AGAP002685XP_312238.3 GABARAP 5..116 CDD:176355 106/110 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 210 1.000 Domainoid score I6057
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H134420
Inparanoid 1 1.050 233 1.000 Inparanoid score I5802
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - oto106879
Panther 1 1.100 - - LDO PTHR10969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.