Sequence 1: | NP_727447.1 | Gene: | Atg8a / 32001 | FlyBaseID: | FBgn0052672 | Length: | 121 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_009209.1 | Gene: | GABARAP / 11337 | HGNCID: | 4067 | Length: | 117 | Species: | Homo sapiens |
Alignment Length: | 117 | Identity: | 107/117 - (91%) |
---|---|---|---|
Similarity: | 113/117 - (96%) | Gaps: | 0/117 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
Fly 66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Atg8a | NP_727447.1 | GABARAP | 5..116 | CDD:176355 | 102/110 (93%) |
GABARAP | NP_009209.1 | Interaction with beta-tubulin. /evidence=ECO:0000269|PubMed:9892355 | 1..22 | 16/20 (80%) | |
Ubl_ATG8_GABARAP | 2..116 | CDD:340752 | 104/113 (92%) | ||
Interaction with GPHN. /evidence=ECO:0000250|UniProtKB:Q9DCD6 | 36..117 | 76/80 (95%) | |||
Interaction with GABRG2. /evidence=ECO:0000269|PubMed:9892355 | 36..68 | 31/31 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 204 | 1.000 | Domainoid score | I2960 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1654 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 225 | 1.000 | Inparanoid score | I3517 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S125 |
OMA | 1 | 1.010 | - | - | QHG54038 | |
OrthoDB | 1 | 1.010 | - | - | D1508198at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000590 | |
OrthoInspector | 1 | 1.000 | - | - | oto89035 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_100707 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR10969 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2039 |
SonicParanoid | 1 | 1.000 | - | - | X355 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
15 | 14.820 |