DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Atg8a and nox1

DIOPT Version :9

Sequence 1:	NP_727447.1	Gene:	Atg8a / 32001	FlyBaseID:	FBgn0052672	Length:	121	Species:	Drosophila melanogaster
Sequence 2:	XP_002939249.2	Gene:	nox1 / 100495329	XenbaseID:	XB-GENE-1013455	Length:	571	Species:	Xenopus tropicalis

Alignment Length:	47	Identity:	11/47 - (23%)
Similarity:	24/47 - (51%)	Gaps:	4/47 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    19 DKIRRKYPDRVPVIVEKAPK--ARIGDLDKKKYLVPSDLTVGQFYFL 63
            ::..|.|..|..|::.||..  :::.::..:|.  ...:.|||:.|:
Frog   290 ERTLRFYRSRQTVVITKAVSHPSKVLEIQMQKR--GFKMEVGQYIFI 334

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Atg8a	NP_727447.1	GABARAP	5..116	CDD:176355	11/47 (23%)
nox1	XP_002939249.2	Ferric_reduct	57..214	CDD:366815
nox1	XP_002939249.2	NOX_Duox_like_FAD_NADP	304..571	CDD:99783	7/33 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1654
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900