DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8a and zgc:92606

DIOPT Version :9

Sequence 1:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001002707.1 Gene:zgc:92606 / 100000242 ZFINID:ZDB-GENE-040718-462 Length:117 Species:Danio rerio


Alignment Length:116 Identity:69/116 - (59%)
Similarity:95/116 - (81%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            |..||:.....|.|||||:::|.|:||::|:|||:|.::|..:||||||||||||||||..||||
Zfish     1 MSSQYQRSVPLEVRRAEGERVRAKHPDKIPIIVERAARSRAPELDKKKYLVPSDLTVGQLCFLIR 65

  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYG 116
            :|:.:|||:||||||.|.:||:|:.:.::|:||||||.|||:.||:|:|||
Zfish    66 QRVSMRPEEALFFFVKNSLPPSSSPLSAVYEEHHEEDLFLYMTYSNESVYG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 65/110 (59%)
zgc:92606NP_001002707.1 GABARAP 5..116 CDD:176355 65/110 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.