DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and SPOP

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001007227.1 Gene:SPOP / 8405 HGNCID:11254 Length:374 Species:Homo sapiens


Alignment Length:185 Identity:48/185 - (25%)
Similarity:92/185 - (49%) Gaps:12/185 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPLE 94
            |.:.::..|..|.::.|....|..:...||:.||||||..|.|:....|.|:.:.::.: :|..|
Human   185 RLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPE 249

  Fly    95 AFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARL 159
            .||.::.:||:|.  ...||:.:. |:|..|::|..:.|::...:.|...|:::|...||..|.|
Human   250 VFKEMMCFIYTGK--APNLDKMAD-DLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADL 311

  Fly   160 YNLEELTEVCLMFMDRNAGDLLLHNSFNT-------LSKESLEEVLRRDC-FFAP 206
            ::.::|....:.|::.:|.|:|..:.:.:       |..|:...:....| |..|
Human   312 HSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 29/99 (29%)
BTB 47..145 CDD:197585 29/98 (30%)
BACK_BTBD9_like 145..203 CDD:269811 14/65 (22%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
SPOPNP_001007227.1 MATH_SPOP 28..166 CDD:239743
Required for nuclear localization 71..191 1/5 (20%)
Important for binding substrate proteins 123..133
BTB_POZ_SPOP-like 182..301 CDD:349588 33/118 (28%)
Important for homodimerization 186..217 6/30 (20%)
BACK_SPOP 297..367 CDD:350593 16/70 (23%)
Important for homodimerization 297..355 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.