DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and SPOP

DIOPT Version :10

Sequence 1:NP_572649.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_003554.1 Gene:SPOP / 8405 HGNCID:11254 Length:374 Species:Homo sapiens


Alignment Length:185 Identity:48/185 - (25%)
Similarity:92/185 - (49%) Gaps:12/185 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPLE 94
            |.:.::..|..|.::.|....|..:...||:.||||||..|.|:....|.|:.:.::.: :|..|
Human   185 RLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPE 249

  Fly    95 AFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARL 159
            .||.::.:||:|.  ...||:.:. |:|..|::|..:.|::...:.|...|:::|...||..|.|
Human   250 VFKEMMCFIYTGK--APNLDKMAD-DLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADL 311

  Fly   160 YNLEELTEVCLMFMDRNAGDLLLHNSFNT-------LSKESLEEVLRRDC-FFAP 206
            ::.::|....:.|::.:|.|:|..:.:.:       |..|:...:....| |..|
Human   312 HSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_572649.1 BTB_POZ_BTBD9 24..141 CDD:349596 31/110 (28%)
BACK_BTBD9 145..243 CDD:350518 16/70 (23%)
F5_F8_type_C 299..399 CDD:459925
F5_F8_type_C 451..554 CDD:459925
SPOPNP_003554.1 MATH_SPOP 28..166 CDD:239743
Required for nuclear localization 71..191 1/5 (20%)
Important for binding substrate proteins 123..133
BTB_POZ_SPOP-like 182..301 CDD:349588 33/118 (28%)
Important for homodimerization 186..217 6/30 (20%)
BACK_SPOP 297..367 CDD:350593 16/70 (23%)
Important for homodimerization 297..355 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.