DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Btbd11

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_082985.2 Gene:Btbd11 / 74007 MGIID:1921257 Length:1109 Species:Mus musculus


Alignment Length:181 Identity:43/181 - (23%)
Similarity:85/181 - (46%) Gaps:18/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPLEV-----PLEAFKVLLR 101
            |::.:||.|:||.....||:|:|...|..|:|||   .::.|.....:|:     |:  |:::::
Mouse   924 NKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALL---SSKPTNDNTCIEIGYVKYPI--FQLVMQ 983

  Fly   102 YIYSG---TLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLE 163
            |:|.|   :||:.   .:..:::|..|..:..:.|:........:.:..||...|...|:...:.
Mouse   984 YLYYGGPESLLIK---NNEIMELLSAAKFFQLEALQRHCEIICAKSINTDNCVDIYSHAKFLGVT 1045

  Fly   164 ELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAV 214
            ||:..|..:..:|...|:.:.:|..|..:...|...:|..  .::|..||:
Mouse  1046 ELSAYCEGYFLKNMMVLIENEAFKQLLYDKNGEGAGQDVL--QDLQRTLAI 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 27/106 (25%)
BTB 47..145 CDD:197585 26/105 (25%)
BACK_BTBD9_like 145..203 CDD:269811 13/57 (23%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
Btbd11NP_082985.2 H2A 200..>244 CDD:305064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..302
Ank_4 <585..629 CDD:290365
ANK 603..756 CDD:238125
ANK 1 608..637
ANK repeat 611..652 CDD:293786
Ank_2 613..721 CDD:289560
ANK repeat 654..685 CDD:293786
ANK 2 654..683
ANK repeat 687..717 CDD:293786
ANK 3 692..721
Ank_2 697..>757 CDD:289560
ANK 4 735..764
ANK 5 830..859
BTB 920..1023 CDD:279045 27/106 (25%)
BTB 929..1027 CDD:197585 26/105 (25%)
BACK_like 1027..>1071 CDD:297737 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.