DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Tdpoz9

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001157202.1 Gene:Tdpoz9 / 668359 MGIID:3702970 Length:365 Species:Mus musculus


Alignment Length:209 Identity:55/209 - (26%)
Similarity:91/209 - (43%) Gaps:15/209 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GGKKGAMEQDYTDVV-DLGDRFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALL 75
            |.|.....|:.|..: |.....:.|:..|..|..:.|...:|......||:.||||||..|||:.
Mouse   153 GRKYNMPSQNITPAIKDPRHLLTDDLGELWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAMF 217

  Fly    76 YGGMAETTQRQIPL-EVPLEAFKVLLRYIYSG--TLLLSTLDEDSTIDVLGMANQYGFQDLEMAI 137
            ...|.|:.:..|.: .:..:.||.::.:||:|  ..|.|   .....|||..|::||...|::..
Mouse   218 EHEMKESLKTPIKIHNLNPQVFKEMMSFIYTGKAPYLHS---HSMACDVLPAADKYGLVSLKVLC 279

  Fly   138 SNYLRQYLALDNVCMILDAARLYNLEELTEVCLMFMDRNAGDLL-------LHNSFNTLSKESLE 195
            .:...:.|::.|....|..|.|::.|:|....|.|:...|.::.       :..|...|..|:.:
Mouse   280 EDAFCRNLSVKNATHTLILADLHSTEKLKTQALDFIAYYASEVCETSEWKSMVESHPHLVAEAFQ 344

  Fly   196 EVLRRDC-FFAPEV 208
            .:....| |..|:|
Mouse   345 SLASAQCSFLEPKV 358

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 31/101 (31%)
BTB 47..145 CDD:197585 30/100 (30%)
BACK_BTBD9_like 145..203 CDD:269811 14/65 (22%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139