DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and btbd2a

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001038557.1 Gene:btbd2a / 565970 ZFINID:ZDB-GENE-030829-3 Length:595 Species:Danio rerio


Alignment Length:289 Identity:86/289 - (29%)
Similarity:136/289 - (47%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DRFSADMARLCMNEQYADVEFIVEE----ERIPAHRVILAARSEYFRALLYGGMAET-TQRQIPL 89
            :||    |.|..||..:||.|:|.:    :||||||..||..|..|.|:..||||.| |:.::| 
Zfish   175 ERF----AFLFNNEVLSDVHFLVGKGMGVQRIPAHRFALAVGSAVFDAMFNGGMATTSTEIELP- 234

  Fly    90 EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMIL 154
            :|...||..||:::||..:   .:..::.:..|..|.:|....||.....:|::.|..||..|:|
Zfish   235 DVEPAAFLALLKFLYSDEV---QIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLL 296

  Fly   155 DAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSR 219
            ..|||::..:|..:||..:|:|..|.|....|..:..::|..||.||.....||::|.|..:|:.
Zfish   297 TQARLFDEPQLASLCLENIDKNTADALAAEGFTDVDLDTLVAVLERDTLGVREVRLFGAAVRWAE 361

  Fly   220 F------------NSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALP 272
            .            |........::.:|.|||.:|........||||...:::          :|.
Zfish   362 AEAQRQQLQPTPENKRRVLGKALALIRFPLMTIEEFAAGPAQSGILTDREVV----------SLF 416

  Fly   273 YRAALWPEENVAAETFLSR---CIQG-EC 297
            ....:.|:.:|   .|:.|   |::| ||
Zfish   417 LHFTVNPKPHV---EFIDRPRCCLRGKEC 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 36/103 (35%)
BTB 47..145 CDD:197585 35/102 (34%)
BACK_BTBD9_like 145..203 CDD:269811 21/57 (37%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
btbd2aNP_001038557.1 BTB 180..284 CDD:279045 37/107 (35%)
BTB 188..287 CDD:197585 35/102 (34%)
BACK 299..398 CDD:197943 27/98 (28%)
PHR 446..593 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.