DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and btbd3a

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001139053.1 Gene:btbd3a / 563691 ZFINID:ZDB-GENE-090312-7 Length:461 Species:Danio rerio


Alignment Length:256 Identity:73/256 - (28%)
Similarity:115/256 - (44%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NEQYADVEFIV----EEERIPAHRVILAARSEYFRALLYGGMAETTQR-QIPLEVPLEAFKVLLR 101
            ||..||:.|:|    ..:|:|.|:.:||..|..|.|:.||.:||.... :|| :|...:|..:|:
Zfish    55 NELMADIHFVVGPPGGTQRVPGHKYVLAVGSSVFHAMFYGELAEDKDEIRIP-DVEPPSFLAMLK 118

  Fly   102 YIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELT 166
            |||...:   .|..|:.:..|..|.:|....|..|..|:|...|:..|.|::|..:.|:...:||
Zfish   119 YIYCDEI---DLCADTVLATLYAAKKYIVPHLARACVNFLETSLSARNACVLLSQSCLFEEPDLT 180

  Fly   167 EVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSRF----------- 220
            :.|...:|..|...|....|..:..::||.:|||:...|.|:.:|.|...|:..           
Zfish   181 QRCWEVIDAQAELALRSEGFCDIDTQTLESILRRETLNAKEMVVFEATLSWAEAECHRQELQPTI 245

  Fly   221 -NSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWPE 280
             |..:.....:..:|:|.|.|:.....|..||:|..::..|..        |.|.||..||
Zfish   246 ENKRLVLGKSIYLIRIPAMALDDFANGVAQSGVLTLNETNDIF--------LWYTAAKKPE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 34/103 (33%)
BTB 47..145 CDD:197585 32/102 (31%)
BACK_BTBD9_like 145..203 CDD:269811 17/57 (30%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
btbd3aNP_001139053.1 BTB 52..155 CDD:279045 34/103 (33%)
BTB 60..159 CDD:197585 32/102 (31%)
BACK 165..271 CDD:197943 25/105 (24%)
PHR 316..459 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.