DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and btbd11a

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001314771.1 Gene:btbd11a / 562893 ZFINID:ZDB-GENE-050419-142 Length:1021 Species:Danio rerio


Alignment Length:235 Identity:49/235 - (20%)
Similarity:92/235 - (39%) Gaps:57/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NEQYADVEFIVEEERIPAHRVILAARSEYFRALLYG-GMAETTQRQIPLEVPLEAFKVLLRYIYS 105
            |::.:||.|:||.:...||:|:|...|..|::||.. ..||.|..:|. .|....|:::::|:|.
Zfish   832 NKEMSDVTFLVEGKPFYAHKVLLFTASPRFKSLLSNRPAAENTCIEIS-HVKYNIFQLVMQYLYC 895

  Fly   106 GTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELTEVCL 170
            |                      |.:.|          ::....:..:|.||:.:.|:.|...|.
Zfish   896 G----------------------GTESL----------HIRNTEIMELLSAAKFFQLDALQRHCE 928

  Fly   171 MFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSRFNSNVDFKSVVSYVRL 235
            :...:|            ::.:|..::.:.        ..||...:.:.|......|::|..:.|
Zfish   929 IICSKN------------ITNDSCVDIYKH--------ARFLGALELAGFIEGFFLKNMVLLIEL 973

  Fly   236 PLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRA 275
            .  |.:.||..| |:....|....|.:.:...:.||..|:
Zfish   974 E--NFKQLLYEV-PADSPGPGPSYDVLHDLEQTLALRIRS 1010

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 25/99 (25%)
BTB 47..145 CDD:197585 24/98 (24%)
BACK_BTBD9_like 145..203 CDD:269811 8/57 (14%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
btbd11aNP_001314771.1 H2A 190..276 CDD:305064
ANK 510..663 CDD:238125
ANK 1. /evidence=ECO:0000255 515..544
ANK repeat 518..559 CDD:293786
Ank_2 520..628 CDD:289560
ANK repeat 561..594 CDD:293786
ANK 2. /evidence=ECO:0000255 561..590
ANK repeat 596..624 CDD:293786
ANK 3. /evidence=ECO:0000255 599..628
ANK 4. /evidence=ECO:0000255 642..671
BTB 828..931 CDD:279045 31/131 (24%)
BTB 837..935 CDD:197585 31/142 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.