DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and abtb2a

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_687881.4 Gene:abtb2a / 559451 ZFINID:ZDB-GENE-100422-13 Length:1006 Species:Danio rerio


Alignment Length:189 Identity:48/189 - (25%)
Similarity:80/189 - (42%) Gaps:16/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPLE---VPLEAFKV 98
            |....|.:.:||.|:||.....||||:|.:.|:.||.||....:..|...:.:|   :....||:
Zfish   824 AHFLNNSEMSDVIFVVEGRPFYAHRVLLMSASQRFRDLLSLYQSNGTSDHMAIEITDIKYNTFKM 888

  Fly    99 LLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLE 163
            ::.::|.|......:.....:.:|.:|:.:....|:........:.:.|:|...|...|::....
Zfish   889 MMAHLYCGGAECLDVSASDLLKLLPVAHSFQLPVLKRHCEILCSERINLNNAVSIYRTAKVSEAV 953

  Fly   164 ELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSRFNS 222
            ||...|..|        :|.|..:.|..|:.||:|     ..|||...|.....||.:|
Zfish   954 ELVVFCEGF--------ILQNMVDLLDCEAFEELL-----LDPEVLDGLQATLASRLHS 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 25/101 (25%)
BTB 47..145 CDD:197585 24/100 (24%)
BACK_BTBD9_like 145..203 CDD:269811 15/57 (26%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
abtb2aXP_687881.4 H2A 187..>235 CDD:305064
ANK 505..655 CDD:238125
ANK repeat 513..554 CDD:293786
Ank_2 515..625 CDD:289560
ANK repeat 556..590 CDD:293786
ANK repeat 592..620 CDD:293786
Ank_4 598..655 CDD:290365
BTB 825..928 CDD:279045 25/102 (25%)
BTB 834..935 CDD:197585 24/100 (24%)
SPOP_C_like 935..986 CDD:269810 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.