DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and KBTBD4

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001305645.1 Gene:KBTBD4 / 55709 HGNCID:23761 Length:567 Species:Homo sapiens


Alignment Length:227 Identity:54/227 - (23%)
Similarity:95/227 - (41%) Gaps:38/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFSADMARLCMNEQ-YADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPL 93
            |.:..:.:||:.|: :|||...||......||::|:|:|.:||::....:.|...|.|.| :|..
Human    78 RVAQGIMKLCLEEELFADVTISVEGREFQLHRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSE 142

  Fly    94 EAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAAR 158
            ..|::|:.|||.||:.|..   :...::..:::.|....|....|.:|.:.:.:.|...::..|.
Human   143 SVFQLLVDYIYHGTVKLRA---EELQEIYEVSDMYQLTSLFEECSRFLARTVQVGNCLQVMWLAD 204

  Fly   159 LYNLEEL-----------------TEVCLMFMDRNAGDLLLHN---------------SFNTLSK 191
            .::..||                 ||..|....|...|::...               :||...:
Human   205 RHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDIISDGVPCSQNPTEAIEAWINFNKEER 269

  Fly   192 ESLEEVLRRDC-FFAPEVQIFLAVWKWSRFNS 222
            |:..|.||... .....|.|:|...:.||.:|
Human   270 EAFAESLRTSLKEIGENVHIYLIGKESSRTHS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 29/100 (29%)
BTB 47..145 CDD:197585 28/98 (29%)
BACK_BTBD9_like 145..203 CDD:269811 15/90 (17%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
KBTBD4NP_001305645.1 BTB 88..187 CDD:279045 29/101 (29%)
BTB 95..189 CDD:197585 28/96 (29%)
BACK_like 191..249 CDD:269806 9/57 (16%)
Kelch_2 327..363 CDD:284956
KELCH repeat 328..363 CDD:276965
KELCH repeat 367..414 CDD:276965
mutarot_permut 403..>560 CDD:274642
KELCH repeat 417..463 CDD:276965
KELCH repeat 471..516 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.