Sequence 1: | NP_001259431.1 | Gene: | BTBD9 / 32000 | FlyBaseID: | FBgn0030228 | Length: | 722 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001305645.1 | Gene: | KBTBD4 / 55709 | HGNCID: | 23761 | Length: | 567 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 54/227 - (23%) |
---|---|---|---|
Similarity: | 95/227 - (41%) | Gaps: | 38/227 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 RFSADMARLCMNEQ-YADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPL 93
Fly 94 EAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAAR 158
Fly 159 LYNLEEL-----------------TEVCLMFMDRNAGDLLLHN---------------SFNTLSK 191
Fly 192 ESLEEVLRRDC-FFAPEVQIFLAVWKWSRFNS 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BTBD9 | NP_001259431.1 | BTB | 42..141 | CDD:279045 | 29/100 (29%) |
BTB | 47..145 | CDD:197585 | 28/98 (29%) | ||
BACK_BTBD9_like | 145..203 | CDD:269811 | 15/90 (17%) | ||
F5_F8_type_C | 299..399 | CDD:304887 | |||
F5_F8_type_C | 451..554 | CDD:279139 | |||
KBTBD4 | NP_001305645.1 | BTB | 88..187 | CDD:279045 | 29/101 (29%) |
BTB | 95..189 | CDD:197585 | 28/96 (29%) | ||
BACK_like | 191..249 | CDD:269806 | 9/57 (16%) | ||
Kelch_2 | 327..363 | CDD:284956 | |||
KELCH repeat | 328..363 | CDD:276965 | |||
KELCH repeat | 367..414 | CDD:276965 | |||
mutarot_permut | 403..>560 | CDD:274642 | |||
KELCH repeat | 417..463 | CDD:276965 | |||
KELCH repeat | 471..516 | CDD:276965 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143725 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |