DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and BTBD2

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_060267.2 Gene:BTBD2 / 55643 HGNCID:15504 Length:525 Species:Homo sapiens


Alignment Length:289 Identity:89/289 - (30%)
Similarity:134/289 - (46%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DRFSADMARLCMNEQYADVEFIV----EEERIPAHRVILAARSEYFRALLYGGMAET-TQRQIPL 89
            :||    |.|..||...||.|:|    ..:||||||.:||..|..|.|:..||||.| |:.::| 
Human   105 ERF----AFLFNNEVLCDVHFLVGKGLSSQRIPAHRFVLAVGSAVFDAMFNGGMATTSTEIELP- 164

  Fly    90 EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMIL 154
            :|...||..||:::||..:   .:..::.:..|..|.:|....||.....:|::.|..||..|:|
Human   165 DVEPAAFLALLKFLYSDEV---QIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLL 226

  Fly   155 DAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSR 219
            ..|||::..:|..:||..:|:|..|.:....|..:..::|..||.||.....||::|.||.:||.
Human   227 TQARLFDEPQLASLCLENIDKNTADAITAEGFTDIDLDTLVAVLERDTLGIREVRLFNAVVRWSE 291

  Fly   220 F------------NSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALP 272
            .            |........:..:|.|||.:|........||||        :|....|..|.
Human   292 AECQRQQLQVTPENRRKVLGKALGLIRFPLMTIEEFAAGPAQSGIL--------VDREVVSLFLH 348

  Fly   273 YRAALWPEENVAAETFLSR---CIQG-EC 297
            :  .:.|:..|   .|:.|   |::| ||
Human   349 F--TVNPKPRV---EFIDRPRCCLRGKEC 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 36/103 (35%)
BTB 47..145 CDD:197585 35/102 (34%)
BACK_BTBD9_like 145..203 CDD:269811 20/57 (35%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
BTBD2NP_060267.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86
BTB 110..214 CDD:279045 37/107 (35%)
BTB 118..217 CDD:197585 35/102 (34%)
BACK 229..328 CDD:197943 28/98 (29%)
PHR 376..523 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.