DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and LOC555499

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_005168501.1 Gene:LOC555499 / 555499 -ID:- Length:564 Species:Danio rerio


Alignment Length:289 Identity:87/289 - (30%)
Similarity:135/289 - (46%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DRFSADMARLCMNEQYADVEFIVEE----ERIPAHRVILAARSEYFRALLYGGMAET-TQRQIPL 89
            :||    |.|..||..:||.|:|.:    :||||||.:||..|..|.|:..||||.| |:.::| 
Zfish   144 ERF----AFLFNNEVLSDVHFLVGKGMGVQRIPAHRFVLAVGSAVFDAMFNGGMATTSTEIELP- 203

  Fly    90 EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMIL 154
            :|...||..||:::||..:   .:..::.:..|..|.:|....||.....:|::.|..||..|:|
Zfish   204 DVEPAAFLSLLKFLYSDEV---HIGPETVMTTLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLL 265

  Fly   155 DAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSR 219
            ..|||::..:|..:||..:|:|.||.|....|..:..::|..||.||.....||.:|.|..:|:.
Zfish   266 TQARLFDEPQLASLCLENIDKNTGDALAAEGFTDIDLDTLVAVLERDTLGVREVHLFGAAVRWAE 330

  Fly   220 F------------NSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALP 272
            .            |........:|.:|.|||.:|........|.||...:::          :|.
Zfish   331 AEAHRQQLQPTPENKRRVLGKALSLIRFPLMTIEEFAAGPAQSAILTDREVV----------SLF 385

  Fly   273 YRAALWPEENVAAETFLSR---CIQG-EC 297
            ....:.|:..|   .|:.|   |::| ||
Zfish   386 LHFTVNPKPRV---EFIDRPRCCLRGKEC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 36/103 (35%)
BTB 47..145 CDD:197585 35/102 (34%)
BACK_BTBD9_like 145..203 CDD:269811 22/57 (39%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
LOC555499XP_005168501.1 BTB 149..253 CDD:279045 37/107 (35%)
BTB 157..256 CDD:197585 35/102 (34%)
BACK 268..367 CDD:197943 29/98 (30%)
PHR 415..562 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.