DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and btbd6b

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_005160551.1 Gene:btbd6b / 553533 ZFINID:ZDB-GENE-030829-65 Length:535 Species:Danio rerio


Alignment Length:353 Identity:89/353 - (25%)
Similarity:148/353 - (41%) Gaps:48/353 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NEQYADVEFIV----EEERIPAHRVILAARSEYFRALLYGGMAE-TTQRQIPLEVPLEAFKVLLR 101
            ||..|||.|:|    ..:::|||:.:||..|..|.|:.||.:|| .::..|| :|...||.:||:
Zfish   129 NELMADVHFVVGPPGASQKVPAHKYVLAVGSSVFGAMFYGDLAEGESEIHIP-DVEPAAFLILLK 192

  Fly   102 YIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELT 166
            |:||..:   .|:.|:.:..|..|.:|....|..|...:|...|...|.|::|..:||:...|||
Zfish   193 YMYSDEI---ELEADTVLATLYAAKKYIVPALAKACVTFLETSLEAKNACVLLSQSRLFEEPELT 254

  Fly   167 EVCLMFMDRNAGDLLLHN-SFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKW------------S 218
            ..|...:|..| :|.||: .|..:..::||.:|:|:.....|..:|.|...|            :
Zfish   255 LRCWEVIDAQA-ELALHSEGFCEIDLQTLEIILKRETLNTREAVVFQAALDWAVAECKRQGLGPT 318

  Fly   219 RFNSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILD------AIDERSTSKALPYRAAL 277
            ..|........:..||:|.|.||........|.:|..::..|      |.::......|..|..|
Zfish   319 ARNKRAVLGKALYLVRIPTMTLEEFANGAAQSDVLTLEETHDVFLWYTAANKPKLEFPLQKRKGL 383

  Fly   278 WPE-----ENVAAET----FLSRC--IQGECRDALLDGDVTTYDMENGYTRHCI-TDSKDAGIVV 330
            .|:     ::.|..:    :..||  ||......:....:..|....|...:.: .:.|..|:. 
Zfish   384 TPQRCHRFQSSAYRSNQWRYRGRCDSIQFAVDKRIFIAGLGLYGSSGGKAEYSVKIELKRQGVT- 447

  Fly   331 ELGTFCMINHIRMLLWDRDSRAYSYYVE 358
                  :..::...:.|..|..:|.:.|
Zfish   448 ------LAQNLTKFISDGSSNTFSVWFE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 36/103 (35%)
BTB 47..145 CDD:197585 34/102 (33%)
BACK_BTBD9_like 145..203 CDD:269811 20/58 (34%)
F5_F8_type_C 299..399 CDD:304887 8/61 (13%)
F5_F8_type_C 451..554 CDD:279139
btbd6bXP_005160551.1 BTB 126..229 CDD:279045 36/103 (35%)
BTB 134..233 CDD:197585 34/102 (33%)
BACK 239..345 CDD:197943 29/106 (27%)
PHR 390..533 CDD:285277 13/87 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.