DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Spopfm2l1

DIOPT Version :10

Sequence 1:NP_572649.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001094466.2 Gene:Spopfm2l1 / 502570 RGDID:1559714 Length:268 Species:Rattus norvegicus


Alignment Length:75 Identity:25/75 - (33%)
Similarity:45/75 - (60%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPLEAFKV 98
            |:..|..|..:.|...:|..:.|.:|:.||||||..|||:....|.::.:.:|.: ::.|:.||.
  Rat   177 DLGELWENSLFTDCSLVVAGQEIRSHKAILAARSPVFRAMFEHEMLDSLRNRIEIHDIHLQVFKE 241

  Fly    99 LLRYIYSGTL 108
            ::.:||:||:
  Rat   242 MMHFIYTGTV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_572649.1 BTB_POZ_BTBD9 24..141 CDD:349596 25/75 (33%)
BACK_BTBD9 145..243 CDD:350518
F5_F8_type_C 299..399 CDD:459925
F5_F8_type_C 451..554 CDD:459925
Spopfm2l1NP_001094466.2 MATH 16..153 CDD:445786
BTB_POZ 165..268 CDD:453885 25/75 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.