DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and RGD1564313

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_003749379.1 Gene:RGD1564313 / 502566 RGDID:1564313 Length:364 Species:Rattus norvegicus


Alignment Length:225 Identity:57/225 - (25%)
Similarity:102/225 - (45%) Gaps:38/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSQGHHKMSGGGKKGAMEQDYTDVVDLGDRFSADMARLCMNEQYADVEFIVEEERIPAHRVILA 65
            :|..||          :|..:..|...:   .:.|:..|..|..:.|...:|..:...||:.|||
  Rat   156 LSRPGH----------SMRPEIKDPTQM---LADDVGELWENSLFTDCSLVVAGQEFRAHKAILA 207

  Fly    66 ARSEYFRALLYGGMAETTQRQIPL-EVPLEAFKVLLRYIYSGTL--LLSTLDEDSTIDVLGMANQ 127
            |||..|||:....|.|:...:|.: ::.|:.||.::.:||:|..  |.|   ......:|..|::
  Rat   208 ARSPVFRAMFEHEMLESLTNRIEIHDIHLQVFKEMMAFIYTGKAPHLHS---HSMATGLLAAADK 269

  Fly   128 YGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELTEVCLMFMDRNAGDL------------ 180
            |..|||::...:.|.:.|::.|....|..|.|::.|.|..:.:.|:..:|.::            
  Rat   270 YDLQDLKVICEDSLCRNLSVKNAVPTLILADLHSTEHLKSMAMDFIILHASEVSETLEWKSMVES 334

  Fly   181 ---LLHNSFNTLSKE---SLE-EVLRRDCF 203
               |:..:|.||:..   ||| .::|::.|
  Rat   335 HPHLVEEAFCTLASVHCFSLEPSLIRQNVF 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 31/101 (31%)
BTB 47..145 CDD:197585 31/100 (31%)
BACK_BTBD9_like 145..203 CDD:269811 17/76 (22%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
RGD1564313XP_003749379.1 MATH 16..153 CDD:295307
BTB 180..284 CDD:279045 32/106 (30%)
BTB 189..287 CDD:197585 31/100 (31%)
SPOP_C 287..348 CDD:269807 13/60 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.