DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Tdpoz5

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_997156.2 Gene:Tdpoz5 / 399676 MGIID:3027905 Length:340 Species:Mus musculus


Alignment Length:173 Identity:51/173 - (29%)
Similarity:79/173 - (45%) Gaps:13/173 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GGKKGAMEQDYTDVV-DLGDRFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALL 75
            |...|...|:.|..: |.....:.|:..|..|..:.|...:|......||:.||||||..|||:.
Mouse   153 GSVFGMPGQNITPAIKDPRHLLTDDLGELWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAMF 217

  Fly    76 YGGMAETTQRQIPLEV----PLEAFKVLLRYIYSGTL--LLSTLDEDSTIDVLGMANQYGFQDLE 134
            ...|.|....  |.|:    | :.||.::.:||:|..  |.|   .....|||..|::||.:.|:
Mouse   218 EHEMEERLGN--PTEIHDLDP-KVFKEMMGFIYTGKAPHLQS---HSMATDVLTAADKYGLEGLK 276

  Fly   135 MAISNYLRQYLALDNVCMILDAARLYNLEELTEVCLMFMDRNA 177
            :...:.|.:.|:::|....|..|.|:..|:|....|.|:..:|
Mouse   277 VLCEDALCRNLSVENAAQTLILADLHKREQLKTQALYFIALHA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 33/104 (32%)
BTB 47..145 CDD:197585 33/103 (32%)
BACK_BTBD9_like 145..203 CDD:269811 10/33 (30%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
Tdpoz5NP_997156.2 MATH 16..153 CDD:295307 51/173 (29%)
BTB 178..284 CDD:279045 34/111 (31%)
BTB 189..287 CDD:197585 33/103 (32%)
SPOP_C 287..339 CDD:269807 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.