DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Tdpoz4

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_997155.2 Gene:Tdpoz4 / 399675 MGIID:3027904 Length:370 Species:Mus musculus


Alignment Length:198 Identity:52/198 - (26%)
Similarity:89/198 - (44%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPLEAFKV 98
            |:..|..|..:.|...:|......||:.||||||..|||:....|.|.....:.: ::..:.||.
Mouse   177 DVGELWENPLFTDCSLLVAGHEFRAHKAILAARSPVFRAMFEHEMEERLTNCVEIHDLDPQVFKE 241

  Fly    99 LLRYIYSGTL--LLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYN 161
            ::.:||:|.:  |.|   .....|:|..|::||.:||.:...:.|.:.|:::|....|..|.|::
Mouse   242 MMGFIYTGKVPHLHS---HSMACDLLAAADRYGLEDLMVMCEDALCRSLSVENAAHTLIVADLHS 303

  Fly   162 LEELTEVCLMF-------MDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAV----W 215
            .|.|....|.|       :.:.:|.:.:..|...|..|:...:       |...::|.|:    .
Mouse   304 TEHLKTQALDFIIVYASEVSKTSGWMSMVESHPRLVAEAFHSL-------ASAQRVFWALPFKQL 361

  Fly   216 KWS 218
            |||
Mouse   362 KWS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 30/101 (30%)
BTB 47..145 CDD:197585 30/100 (30%)
BACK_BTBD9_like 145..203 CDD:269811 13/64 (20%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
Tdpoz4NP_997155.2 MATH 16..154 CDD:295307
BTB 180..284 CDD:279045 31/106 (29%)
BTB 189..287 CDD:197585 30/100 (30%)
SPOP_C 287..349 CDD:269807 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.