Sequence 1: | NP_001259431.1 | Gene: | BTBD9 / 32000 | FlyBaseID: | FBgn0030228 | Length: | 722 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997155.2 | Gene: | Tdpoz4 / 399675 | MGIID: | 3027904 | Length: | 370 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 52/198 - (26%) |
---|---|---|---|
Similarity: | 89/198 - (44%) | Gaps: | 24/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 DMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPLEAFKV 98
Fly 99 LLRYIYSGTL--LLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYN 161
Fly 162 LEELTEVCLMF-------MDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAV----W 215
Fly 216 KWS 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BTBD9 | NP_001259431.1 | BTB | 42..141 | CDD:279045 | 30/101 (30%) |
BTB | 47..145 | CDD:197585 | 30/100 (30%) | ||
BACK_BTBD9_like | 145..203 | CDD:269811 | 13/64 (20%) | ||
F5_F8_type_C | 299..399 | CDD:304887 | |||
F5_F8_type_C | 451..554 | CDD:279139 | |||
Tdpoz4 | NP_997155.2 | MATH | 16..154 | CDD:295307 | |
BTB | 180..284 | CDD:279045 | 31/106 (29%) | ||
BTB | 189..287 | CDD:197585 | 30/100 (30%) | ||
SPOP_C | 287..349 | CDD:269807 | 14/68 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833948 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |