DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Btbd6

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_964008.2 Gene:Btbd6 / 399566 MGIID:3026623 Length:539 Species:Mus musculus


Alignment Length:477 Identity:113/477 - (23%)
Similarity:168/477 - (35%) Gaps:145/477 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NEQYADVEFIV----EEERIPAHRVILAARSEYFRALLYGGMAET-TQRQIPLEVPLEAFKVLLR 101
            ||..|||.|||    ...|:|||:.:||..|..|.|:.||.:||. ::..|| :|...||.|||:
Mouse   133 NELMADVHFIVGALGAARRVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIP-DVEPAAFLVLLK 196

  Fly   102 YIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELT 166
            |:||..:   .|:.|:.:..|..|.:|....|..|..|:|...|...|.|::|..:||:...|||
Mouse   197 YMYSDEI---DLEADTVLATLYAAKKYIVPALAKACVNFLETSLEAKNACVLLSQSRLFEEPELT 258

  Fly   167 EVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSR------------ 219
            :.|...:|..|...|....|..:.:::||.::.|:.....|..:|.||..|:.            
Mouse   259 QRCWEVIDAQAEMALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPVTP 323

  Fly   220 FNSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWPEENVA 284
            .|........:..||:|.|.||........|.||..        |.:.:..|.|.||..|     
Mouse   324 HNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTL--------EETHNIFLWYTAAKKP----- 375

  Fly   285 AETFLSRCIQGECRDALLDGDVTTYDMENGYTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRD 349
                            |||..:|                |..|:..:                  
Mouse   376 ----------------LLDFPLT----------------KRKGLAPQ------------------ 390

  Fly   350 SRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGL--- 411
             |.:.:               ..|.|....|:|..         |....|..|:|...:.||   
Mouse   391 -RCHRF---------------QSSAYRSNQWRYRG---------RCDSIQFAVDRRVFIAGLGLY 430

  Fly   412 -----EAMHTAKV--PRLVNHFVAPKTNVATVEMSAIVTDGVSR------------------TRN 451
                 :|.::.|:  .||        ..|....::..|:||.|.                  |.:
Mouse   431 GSSSGKAEYSVKIELKRL--------GMVLAQNLTKFVSDGSSNTFPVWFEHPVQVEQDTFYTAS 487

  Fly   452 ALINGDYVRYDWDSGYTCHQLG 473
            |:::|..:.|....|.|..|.|
Mouse   488 AVLDGSELSYFGQEGMTEVQCG 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 40/103 (39%)
BTB 47..145 CDD:197585 38/102 (37%)
BACK_BTBD9_like 145..203 CDD:269811 17/57 (30%)
F5_F8_type_C 299..399 CDD:304887 12/99 (12%)
F5_F8_type_C 451..554 CDD:279139 7/23 (30%)
Btbd6NP_964008.2 BTB 130..233 CDD:279045 40/103 (39%)
BTB 138..237 CDD:197585 38/102 (37%)
BACK 243..349 CDD:197943 27/105 (26%)
PHR 394..537 CDD:285277 27/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.