DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and kbtbd4

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_956503.1 Gene:kbtbd4 / 393178 ZFINID:ZDB-GENE-040426-937 Length:522 Species:Danio rerio


Alignment Length:514 Identity:106/514 - (20%)
Similarity:168/514 - (32%) Gaps:176/514 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GGKKGAMEQDYTDVVDLGDRFSA-----DMARLCMNE-QYADVEFIVEEERIPAHRVILAARSEY 70
            ||..|  :::|.......||..:     .:..||:.: .:|||...|:.:....||::|:|:|.:
Zfish    11 GGPSG--DENYFQGYTFTDRSHSSRVVKSIMDLCLEDGLFADVIVTVDSKEFQLHRLVLSAQSSF 73

  Fly    71 FRALLYGGMAETTQRQIPL-EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLE 134
            ||::....:.|...|.|.| :|....|:.|:.|||.|.:.|...|...|.:   ||:.|....|.
Zfish    74 FRSMFTSNLREAYDRNIELKDVSATVFQSLVDYIYHGMIKLRVEDLQDTYE---MADMYQLTALF 135

  Fly   135 MAISNYLRQYLALDNVCMILDAARLYNLEELTEVCLMFM---DRNAGDLLLHNSFNTLSKESLEE 196
            ...|.:|.:.:.:.|                   ||..|   ||:: |..|:.:....:|..|.:
Zfish   136 EECSRFLSRTVDVRN-------------------CLQVMWLADRHS-DQELYTAAKHCAKIHLVQ 180

  Fly   197 VLRRDCFFAPEVQIFLAVWKWSRFNSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDA 261
            :.:.|                             .::.|||.    ||..:...|:........|
Zfish   181 LHQTD-----------------------------EFLNLPLC----LLMDIIKDGVPSSQNPTAA 212

  Fly   262 IDERSTSKALPYRAALWPEENVAAETFLSRCIQGECRDALLDGDVTTYDMENGYTRHCITDSKDA 326
            |:.             |...|        :..:.|..|.|||                  ..|:.
Zfish   213 IES-------------WINHN--------KVEREEYSDMLLD------------------SLKEI 238

  Fly   327 GIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVR 391
            |..|         || .|:...|:|.:|..|.:..|:.|                          
Zfish   239 GEKV---------HI-YLIGKEDTRTHSLAVSLHCDEDH-------------------------- 267

  Fly   392 FIRLVGTQNTVNRV---------FHVVGLEA--------MHT------AKVPR-LVNHFVAPKTN 432
            .|.:.|..:..:::         .:|||...        |||      |.:|| .::|     |.
Zfish   268 AISVSGQNSLCHQITAACKHGADLYVVGGSIPRRMWKCNMHTMDWERCAPLPRDRLHH-----TL 327

  Fly   433 VATVEMSAIVTDGVSRTRNALING--DYVRYD--WDSGYTCHQLGSGEIVVRLGQPYYL 487
            |:.....||.:.|....::.|.|.  .|...|  |..........||...|.||...||
Zfish   328 VSVSTEDAIYSLGGKTLQDTLSNAVICYTVKDNIWKETTQLDTAVSGAAGVNLGGTIYL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 30/100 (30%)
BTB 47..145 CDD:197585 30/98 (31%)
BACK_BTBD9_like 145..203 CDD:269811 11/60 (18%)
F5_F8_type_C 299..399 CDD:304887 18/99 (18%)
F5_F8_type_C 451..554 CDD:279139 12/41 (29%)
kbtbd4NP_956503.1 BTB 39..142 CDD:279045 32/105 (30%)
BTB 50..142 CDD:197585 29/94 (31%)
BACK 151..247 CDD:197943 30/178 (17%)
KELCH repeat 283..318 CDD:276965 7/34 (21%)
KELCH repeat 322..369 CDD:276965 11/51 (22%)
KELCH repeat 372..421 CDD:276965 7/15 (47%)
KELCH repeat 424..471 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.