DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and RGD1563667

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001094455.2 Gene:RGD1563667 / 365855 RGDID:1563667 Length:360 Species:Rattus norvegicus


Alignment Length:167 Identity:45/167 - (26%)
Similarity:78/167 - (46%) Gaps:15/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETTQRQIPL-EVPLEAFKV 98
            |:..|..|..:.|...:|..:...:|:.||||.|..|||:....|.|:...:|.: ::.|:.||.
  Rat   177 DIGELWENSLFTDCSLVVAGQEFRSHKAILAACSPVFRAMFEHEMLESLTNRIEIHDIHLQVFKE 241

  Fly    99 LLRYIYSGTL--LLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYN 161
            ::.:||:|..  |.|   ......:|..|::|..|.|:....:.|.:.|::.|....|..|.|:.
  Rat   242 MMAFIYTGKAPHLHS---RSMATGLLAAADKYDLQGLKGMCEDALCRNLSVKNAVPTLILADLHK 303

  Fly   162 LEELTEVCLMFMDRNAGDLLLHNS--FNTLSKESLEE 196
            .|.|....:.|       ::||.|  .:|:..:|:.|
  Rat   304 TEHLKTRAMDF-------IILHASEVSDTVGWKSMVE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 28/101 (28%)
BTB 47..145 CDD:197585 28/100 (28%)
BACK_BTBD9_like 145..203 CDD:269811 14/54 (26%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
RGD1563667NP_001094455.2 MATH 16..154 CDD:351761
BTB_POZ 165..292 CDD:365784 32/117 (27%)
BACK 287..351 CDD:421692 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.