DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and CG7102

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001285729.1 Gene:CG7102 / 34079 FlyBaseID:FBgn0031961 Length:515 Species:Drosophila melanogaster


Alignment Length:386 Identity:88/386 - (22%)
Similarity:172/386 - (44%) Gaps:76/386 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DMARLCMNEQYADVEFIV-EEERIPAHRVILAARSEYFRALLYG---------------GMAETT 83
            |:.||..::..|||.||. .:|||.|||::|.||.:.|:....|               |.:..|
  Fly     9 DLQRLSEDQDSADVVFICGRDERIYAHRLMLMARCKSFKTAKRGEVCRIPGCTVSPAAPGASTPT 73

  Fly    84 QRQIPLEVPLEAFKVLLRYIYSGTLLLSTLDEDSTI-DVLGMANQYGFQDLEMAISNYLRQYLAL 147
            ..::| .|..|.|:..:.|:|:..|:|    :||.: .::.:|...|..:|..|..:::...|::
  Fly    74 TIRLP-HVNPELFRQFILYVYTAKLVL----QDSQVFQMMILAQDIGVVELRTACEDHVISTLSV 133

  Fly   148 DNVCMILDAARLYNLEE---------LTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCF 203
            ||.|..|.|  :.::.|         ..|.|::::..||.:.:..|:|.||:|:::.:::..|.|
  Fly   134 DNACTFLTA--VMDIHEKAGAKCAASFMERCIIYIGENANECVKTNAFLTLTKDAIIKIISSDYF 196

  Fly   204 FAPEVQIFLAVWKWSRFNSNV-----------------DFKSVVSYVRLPLMNLEHLLQVVRPSG 251
            ...|.:::..|..|:::.:.|                 ....|:.:|||.|::.:...:.|.|:|
  Fly   197 CLEEEEVWRCVLSWAKYQAGVTQPTAHWTEEERARVCQHLSGVMGHVRLLLIDSQVFAEEVEPTG 261

  Fly   252 --------------ILDPDKILDAIDERSTSKALPYRAALWP------EENVAAETFLSRCIQGE 296
                          .|..:|::|  :::.....|.....::|      .:|:|.:|.|:..:...
  Fly   262 AVPMELSLERYRYAALHANKMMD--NDKRLQPRLAVAVNMFPGSQILKNDNLALQTVLNNWVGVG 324

  Fly   297 CRDALLDGDVTTYDMENG-YTRHCITDSKDAGIVVELGTFCMIN-HIRMLLWDRDSRAYSY 355
            .:...|....:|:..::| :.|:|  |.....:|:.||:...|: ....:.|.:.||...|
  Fly   325 KQSWRLVFRASTHGYDSGAFHRYC--DGVAPCMVIGLGSHGEISGGYTDVAWAKTSRKGGY 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 32/115 (28%)
BTB 47..145 CDD:197585 31/114 (27%)
BACK_BTBD9_like 145..203 CDD:269811 17/66 (26%)
F5_F8_type_C 299..399 CDD:304887 14/59 (24%)
F5_F8_type_C 451..554 CDD:279139
CG7102NP_001285729.1 BTB 10..128 CDD:279045 34/122 (28%)
BTB 21..131 CDD:197585 31/114 (27%)
BACK 143..255 CDD:197943 21/111 (19%)
TLDc 303..477 CDD:214733 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4350
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.