DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and CG17068

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster


Alignment Length:242 Identity:58/242 - (23%)
Similarity:108/242 - (44%) Gaps:39/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MEQDYTD-VVDLGDRFSADMARLCMNEQYADVEFIV----EEERIPAHRVILAARSEYFRALLYG 77
            |:.|:.: :.:|.||..    .|..:|::||..|:|    .:..|..|:::||..|..|..:.||
  Fly     1 MDIDWQNGLTELKDRGQ----YLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYG 61

  Fly    78 GMAETTQRQIPLEVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLR 142
            .:.:.|...:..:|..|||:.:|.|||:..:.:.:.|:  ..::..:|.:|....:....:::|.
  Fly    62 NLPDKTDPIVIPDVQPEAFEAMLEYIYTDRITIGSFDK--ACELCYVAKKYMLPHVVTRCTHFLW 124

  Fly   143 QYLALDNVCMILDAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPE 207
            ..|:..|.|...:.|:|::...|.:        ::.||:..|:         .|||....|...|
  Fly   125 ADLSPKNACRAYEFAKLFDEPRLMQ--------SSMDLIAANT---------REVLSDPSFLDIE 172

  Fly   208 VQIFLAVWKWSRFNSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILD 254
            |...:|:...:|.|.:.:         |.|.|.  ||:.....|||:
  Fly   173 VSTLMAILDQNRLNIDSE---------LDLFNC--LLKFASERGILN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 25/102 (25%)
BTB 47..145 CDD:197585 24/101 (24%)
BACK_BTBD9_like 145..203 CDD:269811 12/57 (21%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
CG17068NP_608379.1 BTB 19..123 CDD:279045 26/105 (25%)
BTB 27..127 CDD:197585 24/101 (24%)
BACK 136..>199 CDD:197943 19/90 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.