DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Klhl11

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001099308.1 Gene:Klhl11 / 287706 RGDID:1306673 Length:709 Species:Rattus norvegicus


Alignment Length:430 Identity:98/430 - (22%)
Similarity:174/430 - (40%) Gaps:108/430 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGGGKKGAMEQDY---TDVVDLGDRFSADMARLCMNEQ-----YADV----------EFIVEEER 56
            :|||..|...:|:   |...:|..|         .|||     :.|:          ||      
  Rat    60 TGGGDPGPEAEDFECSTHCSELSWR---------QNEQRRQGLFCDITLCFGGAGGREF------ 109

  Fly    57 IPAHRVILAARSEYFRALLYGGMAETTQRQI--------PLEVPLEAFKVLLRYIYSGTLLLSTL 113
             .|||.:|||.:|||..||.|..:|:...::        |...| :..:.::.|:|:|.:.:|| 
  Rat   110 -RAHRSVLAAATEYFTPLLSGQFSESRSGRVEMRKWSSEPGPEP-DTVEAVIEYMYTGRIRVST- 171

  Fly   114 DEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELTEVCLMFMDRNAG 178
              .|..:||.:|:::....|:.....:|::.|.|.|...|...|.:|.|.:|.        ..|.
  Rat   172 --GSVHEVLELADRFLLIRLKEFCGEFLKKKLHLSNCVAIHSLAHMYTLSQLA--------LKAA 226

  Fly   179 DLLLHNSFNTLSKE---SLEEVLRRDCFFAPEVQI------FLAVWKWSRFNSNVD---FKSVVS 231
            |::..|.:..:..|   :|...|.||.....|:.:      |..|.||.:.|:...   |:.:..
  Rat   227 DMIRRNFYKVIQDEEFYTLPFHLIRDWLSDLEITVDSEEVLFETVLKWVQRNAEERERYFEELFK 291

  Fly   232 YVRLPLMNLEHLLQVVRPSGILDPDK-----ILDAIDERSTSKALPYRAALWPEENVAAETFLSR 291
            .:||..|...:|.:.|:|..::..::     :.:|: ||...:|          ||:.:.|....
  Rat   292 LLRLSQMKPTYLTRHVKPERLVANNEVCVKLVAEAV-ERHALRA----------ENIQSGTLQHP 345

  Fly   292 CIQ-------GECRDALL-DGDVTTYDMENG-YTRHCITDSKDAGIVVELGTFCMINHIRMLLWD 347
            ..|       |:..|.:: .|.|:    |.| |...|:      |..|:...:..:.||...|  
  Rat   346 TSQVSLLPRYGQNMDVIMVIGGVS----EGGDYLSECV------GYFVDEDRWVNLPHIHNHL-- 398

  Fly   348 RDSRAYSY---YVEVSGDQQ-HWDRVVDYSDYHCRSWQYL 383
             |..|.:.   ||.|:|..: .:.:.|:..:.:..:|:::
  Rat   399 -DGHAVAITESYVYVAGSMEPGFAKTVERYNPNLNTWEHV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 31/121 (26%)
BTB 47..145 CDD:197585 29/115 (25%)
BACK_BTBD9_like 145..203 CDD:269811 16/60 (27%)
F5_F8_type_C 299..399 CDD:304887 20/91 (22%)
F5_F8_type_C 451..554 CDD:279139
Klhl11NP_001099308.1 BTB_POZ_KLHL11 72..206 CDD:349550 37/153 (24%)
PHA03098 91..554 CDD:222983 87/390 (22%)
BACK_KLHL11 201..288 CDD:350526 23/94 (24%)
KELCH repeat 400..440 CDD:276965 7/38 (18%)
KELCH repeat 444..489 CDD:276965
KELCH repeat 492..542 CDD:276965
KELCH repeat 568..650 CDD:276965
Kelch 612..658 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.