DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and BTBD3

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001381934.1 Gene:BTBD3 / 22903 HGNCID:15854 Length:522 Species:Homo sapiens


Alignment Length:276 Identity:77/276 - (27%)
Similarity:122/276 - (44%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ARLCMNEQYADVEFIV----EEERIPAHRVILAARSEYFRALLYGGMAETTQR-QIPLEVPLEAF 96
            |.:..|:..|||.|:|    ..:|:|.|:.:||..|..|.|:.||.:||.... :|| :|...||
Human   111 AMMFNNDLMADVHFVVGPPGGTQRLPGHKYVLAVGSSVFHAMFYGELAEDKDEIRIP-DVEPAAF 174

  Fly    97 KVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYN 161
            ..:|:|||...:.|:.   |:.:..|..|.:|....|..|..|:|...|:..|.|::|..:.|:.
Human   175 LAMLKYIYCDEIDLAA---DTVLATLYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQSCLFE 236

  Fly   162 LEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSRF------ 220
            ..:||:.|...:|..|...|....|..:..::||.:|||:...|.|:.:|.|...|:..      
Human   237 EPDLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNAKEIVVFEAALNWAEVECQRQD 301

  Fly   221 ------NSNVDFKSVVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWP 279
                  |........:..:|:|.|.|:........||:|..::..|..        |.|.||..|
Human   302 LALSIENKRKVLGKALYLIRIPTMALDDFANGAAQSGVLTLNETNDIF--------LWYTAAKKP 358

  Fly   280 EENVAAETFLSRCIQG 295
            |..     |:|:..:|
Human   359 ELQ-----FVSKARKG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 35/103 (34%)
BTB 47..145 CDD:197585 34/102 (33%)
BACK_BTBD9_like 145..203 CDD:269811 17/57 (30%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
BTBD3NP_001381934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..44
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.