DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and Btbd2

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001366013.1 Gene:Btbd2 / 208198 MGIID:1933831 Length:514 Species:Mus musculus


Alignment Length:296 Identity:90/296 - (30%)
Similarity:137/296 - (46%) Gaps:50/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DRFSADMARLCMNEQYADVEFIV----EEERIPAHRVILAARSEYFRALLYGGMAET-TQRQIPL 89
            :||    |.|..||...||.|:|    ..:|:||||.:||..|..|.|:..||||.| |:.::| 
Mouse    88 ERF----AFLFNNEVLCDVHFLVGKGLSSQRVPAHRFVLAVGSAVFDAMFNGGMATTSTEIELP- 147

  Fly    90 EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMIL 154
            :|...||..||:::||..:   .:..::.:..|..|.:|....||.....:|:::|..||..|:|
Mouse   148 DVEPAAFLALLKFLYSDEV---QIGPETVMTTLYTAKKYAVPALEAHCVEFLKKHLRADNAFMLL 209

  Fly   155 DAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSR 219
            ..|||::..:|..:||..:|:|..|.:....|..:..::|..||.||.....||::|.||.:||.
Mouse   210 TQARLFDEPQLASLCLESIDKNTADAIAAEGFTDIDLDTLVAVLERDTLGIREVRLFNAVVRWSE 274

  Fly   220 F------------NSNVDFKSVVSYVRLPLMNLEHLLQVVRP-------SGILDPDKILDAIDER 265
            .            |........:|.:|.|||.:|. .....|       ||||        :|..
Mouse   275 AECQRQQLQVTPENKRKVLGKALSLIRFPLMTIEE-FAAASPLPAGPAQSGIL--------VDRE 330

  Fly   266 STSKALPYRAALWPEENVAAETFLSR---CIQG-EC 297
            ..|..|.:  .:.|:..|   .|:.|   |::| ||
Mouse   331 VVSLFLHF--TVNPKPRV---EFIDRPRCCLRGKEC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 35/103 (34%)
BTB 47..145 CDD:197585 34/102 (33%)
BACK_BTBD9_like 145..203 CDD:269811 20/57 (35%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
Btbd2NP_001366013.1 BTB_POZ_BTBD1_2 78..204 CDD:349590 41/123 (33%)
BACK_BTBD2 200..305 CDD:350598 31/104 (30%)
PHR 364..513 CDD:400388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.