DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and btbd11b

DIOPT Version :9

Sequence 1:NP_001259431.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_003200483.1 Gene:btbd11b / 100034519 ZFINID:ZDB-GENE-050419-99 Length:1012 Species:Danio rerio


Alignment Length:173 Identity:41/173 - (23%)
Similarity:70/173 - (40%) Gaps:47/173 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NEQYADVEFIVEEERIPAHRVILAARSEYFRALLYG-GMAETTQRQIPLEVPLEAFKVLLRYIYS 105
            |::.:||.|:||.:...||:|:|...|..|:.||.. ..||.|..:|. .|....|:::::|:|.
Zfish   827 NKEMSDVTFLVEGKPFYAHKVLLFTASNRFKLLLANRPAAENTCIEIS-HVKYNVFQLVMQYLYC 890

  Fly   106 GTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELTEVCL 170
            |           ..|.|.:.|                     ..|..:|.|::.:.||.|...| 
Zfish   891 G-----------GTDALHIRN---------------------TEVMDLLSASKFFQLEALQRHC- 922

  Fly   171 MFMDRNAGDLLLHNSFNTLSKESLEEVLRRDCFF-APEVQIFL 212
                    :::...:.||   |:..|:.....|. |||:..::
Zfish   923 --------EIICAKNINT---ETCVEIYNHAKFLEAPELSAYI 954

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_001259431.1 BTB 42..141 CDD:279045 26/99 (26%)
BTB 47..145 CDD:197585 25/98 (26%)
BACK_BTBD9_like 145..203 CDD:269811 11/57 (19%)
F5_F8_type_C 299..399 CDD:304887
F5_F8_type_C 451..554 CDD:279139
btbd11bXP_003200483.1 H2A 189..275 CDD:305064
ANK 506..659 CDD:238125
ANK repeat 514..555 CDD:293786
Ank_2 516..622 CDD:289560
ANK repeat 557..590 CDD:293786
ANK repeat 592..620 CDD:293786
ANK repeat 630..668 CDD:293786
BTB 823..926 CDD:279045 33/140 (24%)
BTB 832..930 CDD:197585 32/139 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.