Sequence 1: | NP_001259431.1 | Gene: | BTBD9 / 32000 | FlyBaseID: | FBgn0030228 | Length: | 722 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957424.1 | Gene: | spop / 100005514 | ZFINID: | ZDB-GENE-040426-1378 | Length: | 374 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 99/197 - (50%) | Gaps: | 13/197 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 QDYTDVVDLGD-RFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETT 83
Fly 84 QRQIPL-EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLAL 147
Fly 148 DNVCMILDAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNT-------LSKESLEEVLRRDC-FF 204
Fly 205 AP 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BTBD9 | NP_001259431.1 | BTB | 42..141 | CDD:279045 | 28/99 (28%) |
BTB | 47..145 | CDD:197585 | 29/98 (30%) | ||
BACK_BTBD9_like | 145..203 | CDD:269811 | 13/65 (20%) | ||
F5_F8_type_C | 299..399 | CDD:304887 | |||
F5_F8_type_C | 451..554 | CDD:279139 | |||
spop | NP_957424.1 | MATH_SPOP | 28..166 | CDD:239743 | |
Required for nuclear localization. /evidence=ECO:0000250 | 71..191 | 4/17 (24%) | |||
BTB_POZ | 179..301 | CDD:365784 | 34/124 (27%) | ||
BACK_SPOP | 297..367 | CDD:350593 | 15/70 (21%) | ||
Homodimerization. /evidence=ECO:0000250 | 297..355 | 12/57 (21%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170576663 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |