DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTBD9 and spop

DIOPT Version :10

Sequence 1:NP_572649.1 Gene:BTBD9 / 32000 FlyBaseID:FBgn0030228 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_957424.1 Gene:spop / 100005514 ZFINID:ZDB-GENE-040426-1378 Length:374 Species:Danio rerio


Alignment Length:197 Identity:49/197 - (24%)
Similarity:99/197 - (50%) Gaps:13/197 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QDYTDVVDLGD-RFSADMARLCMNEQYADVEFIVEEERIPAHRVILAARSEYFRALLYGGMAETT 83
            |:..::|.:.| |.:.::..|..:.::.|....|..:...||:.||||||..|.|:....|.|:.
Zfish   173 QNTMNMVKVPDCRLADELGGLWEHSRFTDCSLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESK 237

  Fly    84 QRQIPL-EVPLEAFKVLLRYIYSGTLLLSTLDEDSTIDVLGMANQYGFQDLEMAISNYLRQYLAL 147
            :.::.: :|..|.||.::.:||:|.  ...||:.:. |:|..|::|..:.|::...:.|...|::
Zfish   238 KNRVEINDVEAEVFKEMMFFIYTGK--APNLDKMAD-DLLAAADKYALERLKVMCEDALCTSLSV 299

  Fly   148 DNVCMILDAARLYNLEELTEVCLMFMDRNAGDLLLHNSFNT-------LSKESLEEVLRRDC-FF 204
            :|...||..|.|::.::|....:.|::.:|.|::..:.:.:       |..|:...:....| |.
Zfish   300 ENAAEILILADLHSADQLKTQAVDFINYHASDVMETSGWKSMVASHPHLVAEAYRSLASAQCPFL 364

  Fly   205 AP 206
            .|
Zfish   365 GP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTBD9NP_572649.1 BTB_POZ_BTBD9 24..141 CDD:349596 32/118 (27%)
BACK_BTBD9 145..243 CDD:350518 15/70 (21%)
F5_F8_type_C 299..399 CDD:459925
F5_F8_type_C 451..554 CDD:459925
spopNP_957424.1 MATH_SPOP 28..166 CDD:239743
Required for nuclear localization. /evidence=ECO:0000250 71..191 4/17 (24%)
BTB_POZ 179..301 CDD:453885 34/124 (27%)
BACK_SPOP 297..367 CDD:350593 15/70 (21%)
Homodimerization. /evidence=ECO:0000250 297..355 12/57 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.