DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA3 and Ubx

DIOPT Version :9

Sequence 1:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:314 Identity:90/314 - (28%)
Similarity:116/314 - (36%) Gaps:113/314 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    20 AANGFAYNANQQPYPASAALGADGEYHRP-ACSLQSP-----SSAGGHPKAHELSEA-------- 70
            |..|.|.|||.|..||.      |...|| ||:..|.     .::||.|.:|....|        
  Fly   133 ANGGNAANANGQNNPAG------GMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSG 191

Human    71 ------------------------CLRTLSAPPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQP 111
                                    |  |:|...:|                              
  Fly   192 GNGNAGGVQSGVGVAGAGTAWNANC--TISGAAAQ------------------------------ 224

Human   112 PAPTPAAPPPPSSASPPQNASNN---PTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSS 173
                      .::||....|||:   |..|.|.:.|  ..||.:|        .|.:..|....|
  Fly   225 ----------TAAASSLHQASNHTFYPWMAIAGECP--EDPTKSK--------IRSDLTQYGGIS 269

Human   174 SS-----GESCAGDKSPPGQASS---KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNL 230
            :.     .||.||...|....::   :|.|..||..|.:|||||||.|.||.|.||:|||:.|.|
  Fly   270 TDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCL 334

Human   231 TERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGA------GGYLN 278
            |||||||||||||||.||:.:....|.....|:.::......|      ||:|:
  Fly   335 TERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGHLD 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 11/74 (15%)
Antp-type hexapeptide 155..160 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 9/44 (20%)
Homeobox 195..248 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 8/38 (21%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
UbxNP_536752.1 Homeobox 299..352 CDD:395001 37/52 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.