Sequence 1: | NP_001371264.1 | Gene: | HOXA3 / 3200 | HGNCID: | 5104 | Length: | 443 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
Alignment Length: | 405 | Identity: | 105/405 - (25%) |
---|---|---|---|
Similarity: | 134/405 - (33%) | Gaps: | 186/405 - (45%) |
- Green bases have known domain annotations that are detailed below.
Human 5 TYYDSSAIYGGYP--------YQAANGFAYNANQQ---PYPASA---------ALGADGE----- 44
Human 45 YHRPACSLQSPSS-AGG------------------------------------------------ 60
Human 61 ----HPKAHE----LSEAC-LRTLSAPPSQPPSLGEPPL-----------------HPPPPQA-- 97
Human 98 ----------------------------APPAPQPP-------QPAPQPPAPTPAAPPPPSSASP 127
Human 128 PQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCAGDKSPPGQASSK 192
Human 193 RARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLT 257
Human 258 SSGGQ----SPSRSP 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXA3 | NP_001371264.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..147 | 24/125 (19%) | |
Antp-type hexapeptide | 155..160 | 2/4 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 159..196 | 3/36 (8%) | |||
Homeobox | 195..248 | CDD:395001 | 38/52 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 247..338 | 11/26 (42%) | |||
DUF4074 | 378..441 | CDD:404218 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 400..443 | ||||
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 33/184 (18%) |
Homeobox | 301..354 | CDD:395001 | 38/52 (73%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |