DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA3 and Antp

DIOPT Version :9

Sequence 1:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:405 Identity:105/405 - (25%)
Similarity:134/405 - (33%) Gaps:186/405 - (45%)


- Green bases have known domain annotations that are detailed below.


Human     5 TYYDSSAIYGGYP--------YQAANGFAYNANQQ---PYPASA---------ALGADGE----- 44
            :|..:...:|.||        .|..:.::.|||.|   |||...         ..|.|.:     
  Fly    18 SYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQV 82

Human    45 YHRPACSLQSPSS-AGG------------------------------------------------ 60
            |.||    .|||| .||                                                
  Fly    83 YSRP----DSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVT 143

Human    61 ----HPKAHE----LSEAC-LRTLSAPPSQPPSLGEPPL-----------------HPPPPQA-- 97
                ||:..:    :..:| |:.........|..|.|||                 |...|||  
  Fly   144 QQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQL 208

Human    98 ----------------------------APPAPQPP-------QPAPQPPAPTPAAPPPPSSASP 127
                                        .||...||       |..||.....|....|||. :|
  Fly   209 GYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQ-NP 272

Human   128 PQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCAGDKSPPGQASSK 192
            ...:|..|:|                 ::|||:......:::                      |
  Fly   273 NSQSSGMPSP-----------------LYPWMRSQFGKCQER----------------------K 298

Human   193 RARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLT 257
            |.|..||..|.:||||||||||||.|.||:|:|:.|.||||||||||||||||:||:.|.||. .
  Fly   299 RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGE-P 362

Human   258 SSGGQ----SPSRSP 268
            .|||:    :|..||
  Fly   363 GSGGEGDEITPPNSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 24/125 (19%)
Antp-type hexapeptide 155..160 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 3/36 (8%)
Homeobox 195..248 CDD:395001 38/52 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 11/26 (42%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/184 (18%)
Homeobox 301..354 CDD:395001 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.