DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA3 and zen2

DIOPT Version :9

Sequence 1:NP_001371264.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:171 Identity:61/171 - (35%)
Similarity:79/171 - (46%) Gaps:46/171 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   132 SNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCAGDKSPPGQASSKRART 196
            |.|....|.:.|.|:..|.|...:          ....|:::.|.|            .|||:||
  Fly     6 SENYFVDNYSVSDLMMYPCVELNV----------EAAPTATTRSSE------------KSKRSRT 48

Human   197 AYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGG 261
            |::|.||:|||:|||.|:||.|.||:|::..|.|||||:||||||||||.||....||.:     
  Fly    49 AFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAI----- 108

Human   262 QSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSKPPQ 302
                      ||         |..|:|...||.....|..|
  Fly   109 ----------GA---------LTTSIPLSSQSSEDLQKDDQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA3NP_001371264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 5/14 (36%)
Antp-type hexapeptide 155..160 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 6/36 (17%)
Homeobox 195..248 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 13/56 (23%)
DUF4074 378..441 CDD:404218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.