DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11Lbeta and sdcbp

DIOPT Version :9

Sequence 1:NP_727440.3 Gene:X11Lbeta / 31997 FlyBaseID:FBgn0052677 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_999963.2 Gene:sdcbp / 407719 ZFINID:ZDB-GENE-081104-57 Length:307 Species:Danio rerio


Alignment Length:191 Identity:51/191 - (26%)
Similarity:92/191 - (48%) Gaps:16/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1942 IFGDELEIFAKKELQ---KEVVVPK-AKGEI-LGVVIVESGWGSMLPTVVIANLMSSGAAARCGQ 2001
            |.|.:|.: .:.|::   :|||:.| ..|:| |.:..:::|        |...|:.:..||....
Zfish   105 ITGSDLGV-KRAEIRQGVREVVLCKDMDGKIGLRLKAIDNG--------VFVQLVQANTAAALAG 160

  Fly  2002 LNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQ 2066
            |..|||::.|||.|..|.........:||:..:.:.  ..|...|:........:...||||..:
Zfish   161 LRFGDQILEINGKSCAGWNSDYAHKVLKNSNPERIT--LAVRDRPLERTVTLHKDMNGQLGFIFR 223

  Fly  2067 NGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVGEILMKTMPTSMF 2127
            .|.|.|:::...:.|.|:...|:|.|||.|:::.:...:|:::|.:|.|.:.:..||..:|
Zfish   224 KGRITSIVKDSSSARNGLLTDHQICEINGQNIIGLKDTQIMDILNSSGGVVTITVMPVVIF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LbetaNP_727440.3 PTB_X11 1770..1924 CDD:269919
PDZ_signaling 1957..2042 CDD:238492 23/86 (27%)
PDZ_signaling 2047..2120 CDD:238492 19/72 (26%)
sdcbpNP_999963.2 PDZ_signaling 121..200 CDD:238492 23/88 (26%)
PDZ_signaling 205..278 CDD:238492 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.