DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11Lbeta and Sdcbp2

DIOPT Version :9

Sequence 1:NP_727440.3 Gene:X11Lbeta / 31997 FlyBaseID:FBgn0052677 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_001020863.1 Gene:Sdcbp2 / 311532 RGDID:1307709 Length:296 Species:Rattus norvegicus


Alignment Length:229 Identity:55/229 - (24%)
Similarity:96/229 - (41%) Gaps:31/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1937 LNSQEI--------FGDELEIFAKKELQKEVVVPKAKGEILGVVIVE---------------SGW 1978
            |:|||:        .||.:.|.:....|   |.....|..|||:..|               ...
  Rat    62 LSSQEVQKNLSQIPDGDNMVITSPGPGQ---VTAPVSGNDLGVLRAEIKPGVREIHLCKDERGKT 123

  Fly  1979 GSMLPTV---VIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFT 2040
            |..|..|   :...|:.:...|....|..|||::.|:|....|......|..:|....:.:|  .
  Rat   124 GLRLQAVDKGLFVQLVQANTPASLVGLRFGDQILQIDGCDCAGWSTHKAQKALKKASAEKIV--M 186

  Fly  2041 VVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEK 2105
            ||...|.........::..|:||.::.|.|.|:::|..|.|.|:...|.:.|:|.|:|:.:..:|
  Rat   187 VVRDRPFQRTVTMHKDSSGQVGFFIKKGKIVSVVKGSSAARNGLLTNHYVCEVNGQNVIGLKDKK 251

  Fly  2106 IVNLLATSVGEILMKTMPTSMFRLLTGQENPIYI 2139
            |:.:|.|:...|.:..:||.::..:..:.:|:.:
  Rat   252 IIEILTTAGNVITLTIIPTVIYEHMIKKLSPLLL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LbetaNP_727440.3 PTB_X11 1770..1924 CDD:269919
PDZ_signaling 1957..2042 CDD:238492 21/102 (21%)
PDZ_signaling 2047..2120 CDD:238492 20/72 (28%)
Sdcbp2NP_001020863.1 PDZ_signaling 110..189 CDD:238492 16/80 (20%)
PDZ_signaling 195..268 CDD:238492 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.