DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11Lbeta and SDCBP2

DIOPT Version :9

Sequence 1:NP_727440.3 Gene:X11Lbeta / 31997 FlyBaseID:FBgn0052677 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_001186713.1 Gene:SDCBP2 / 27111 HGNCID:15756 Length:292 Species:Homo sapiens


Alignment Length:154 Identity:36/154 - (23%)
Similarity:71/154 - (46%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1986 VIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFTVVPCAPVVEV 2050
            :...|:.:...|....|..||||:.|:|....|.........:|......:|  .||...|....
Human   130 LFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIV--VVVR
DRPFQRT 192

  Fly  2051 KIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVAVPHEKIVNLLATSVG 2115
            .....::...:||.::.|.|.||::|..|.|.|:...|.:.|::.|:|:.:..:||:.:|||:..
Human   193 VTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGN 257

  Fly  2116 EILMKTMPTSMFRLLTGQENPIYI 2139
            .:.:..:|:.::..:..:..|:.:
Human   258 VVTLTIIPSVIYEHMVKKLPPVLL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LbetaNP_727440.3 PTB_X11 1770..1924 CDD:269919
PDZ_signaling 1957..2042 CDD:238492 12/55 (22%)
PDZ_signaling 2047..2120 CDD:238492 19/72 (26%)
SDCBP2NP_001186713.1 PDZ 117..185 CDD:238080 13/56 (23%)
PDZ_signaling 191..264 CDD:238492 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.