Sequence 1: | NP_727440.3 | Gene: | X11Lbeta / 31997 | FlyBaseID: | FBgn0052677 | Length: | 2139 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_663510.1 | Gene: | Sdcbp2 / 228765 | MGIID: | 2385156 | Length: | 292 | Species: | Mus musculus |
Alignment Length: | 235 | Identity: | 51/235 - (21%) |
---|---|---|---|
Similarity: | 95/235 - (40%) | Gaps: | 43/235 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1946 ELEIF-----AKKELQKEV------------------VVPKAKGEILGVVIVE------------ 1975
Fly 1976 ---SGWGSMLPTV---VIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQ 2034
Fly 2035 TVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVV 2099
Fly 2100 AVPHEKIVNLLATSVGEILMKTMPTSMFRLLTGQENPIYI 2139 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
X11Lbeta | NP_727440.3 | PTB_X11 | 1770..1924 | CDD:269919 | |
PDZ_signaling | 1957..2042 | CDD:238492 | 21/120 (18%) | ||
PDZ_signaling | 2047..2120 | CDD:238492 | 20/72 (28%) | ||
Sdcbp2 | NP_663510.1 | PDZ | 117..185 | CDD:238080 | 15/69 (22%) |
PDZ_signaling | 191..264 | CDD:238492 | 20/72 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167845953 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |