DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment X11Lbeta and Sdcbp2

DIOPT Version :9

Sequence 1:NP_727440.3 Gene:X11Lbeta / 31997 FlyBaseID:FBgn0052677 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_663510.1 Gene:Sdcbp2 / 228765 MGIID:2385156 Length:292 Species:Mus musculus


Alignment Length:235 Identity:51/235 - (21%)
Similarity:95/235 - (40%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1946 ELEIF-----AKKELQKEV------------------VVPKAKGEILGVVIVE------------ 1975
            |||.:     :.:|:||.:                  ||....|..||::..|            
Mouse    49 ELESYMGLSLSSQEVQKNLTQIPDSDNMVVTSPGPGQVVAPVSGNNLGILRAEIKPGVREIHLCK 113

  Fly  1976 ---SGWGSMLPTV---VIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQ 2034
               ...|..|..|   :...|:.:...|....|..|||::.|:|....|.........:|....:
Mouse   114 DERGKTGLRLQAVDKGLFVQLVQANTPASLVGLRFGDQILQIDGCDCAGWNTHKAHKVLKKASAE 178

  Fly  2035 TVVKFTVVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVV 2099
            .:|  .|:...|.........::..|:|||::.|.|.|:::|..|.|.|:...|.:.|:|.|:|:
Mouse   179 KIV--MVIRDRPFQRTVTMHKDSSGQVGFSIKKGKIVSVVKGSSAARNGLLTNHYVCEVNGQNVI 241

  Fly  2100 AVPHEKIVNLLATSVGEILMKTMPTSMFRLLTGQENPIYI 2139
            .:..:|:..:|.|:...|.:..:||.::..:..:.:|:.:
Mouse   242 GLKDKKVTEILTTAGDVITLTIIPTVIYEHMIKRLSPLLL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
X11LbetaNP_727440.3 PTB_X11 1770..1924 CDD:269919
PDZ_signaling 1957..2042 CDD:238492 21/120 (18%)
PDZ_signaling 2047..2120 CDD:238492 20/72 (28%)
Sdcbp2NP_663510.1 PDZ 117..185 CDD:238080 15/69 (22%)
PDZ_signaling 191..264 CDD:238492 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845953
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.