DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2111 and AOPEP

DIOPT Version :9

Sequence 1:NP_572644.1 Gene:CG2111 / 31995 FlyBaseID:FBgn0030223 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001372995.1 Gene:AOPEP / 84909 HGNCID:1361 Length:859 Species:Homo sapiens


Alignment Length:424 Identity:72/424 - (16%)
Similarity:139/424 - (32%) Gaps:130/424 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 PNHAREAFPCFDDPIFRTPFKINLAHPYLYRALSNMPVQRTIRHASLKDYVWTQ-----FVESHP 219
            |.:.|..|||.:.|:..:.::..:      ||.::..|..:..:::....:|.:     :..:.|
Human   275 PINNRALFPCQEPPVAMSTWQATV------RAAASFVVLMSGENSAKPTQLWEECSSWYYYVTMP 333

  Fly   220 MQTYLVAFMISKFDRPGFTSSERSDC----PISTWA-------RPDALSQTEFANM--------- 264
            |              |..|.:....|    .:.||:       ||.:.|:..|.::         
Human   334 M--------------PASTFTIAVGCWTEMKMETWSSNDLATERPFSPSEANFRHVGVCSHMEYP 384

  Fly   265 ----------------------------------VVAPLLSFYEDLFNSTYRQKKIDLVALPDFT 295
                                              ::.|.||....:..: :...::|::.:|   
Human   385 CRFQNASATTQEIIPHRVFAPVCLTGACQETLLRLIPPCLSAAHSVLGA-HPFSRLDVLIVP--- 445

  Fly   296 FKSKENWGLPAFAEESLLYDSQRSSIDDQQGVARAVAMMVVNQWFGNLVSVAWWHEIWLKNVFAL 360
                .|:.....|...:::.||.............:...:.:.|||..:....|.|.||...||.
Human   446 ----ANFPSLGMASPHIMFLSQSILTGGNHLCGTRLCHEIAHAWFGLAIGARDWTEEWLSEGFAT 506

  Fly   361 YLSRF---GVHSLRPEWDYQERHALQL------------------YLSVL----DYDAHVNTDLV 400
            :|...   ....|.|   |:.|...:|                  .:.||    |...|.:..  
Human   507 HLEDVFWATAQQLAP---YEAREQQELRACLRWRRLQDEMQCSPEEMQVLRPSKDKTGHTSDS-- 566

  Fly   401 TASV------PDESHIWAAYNEIGERKAAVLFEMLHRVMGEEAWLTALRRYLVVYANRTATSSDF 459
            .|||      |::     .:.::...|...|...|.:.:|:|.:.:.||:::..:..:...|.||
Human   567 GASVIKHGLNPEK-----IFMQVHYLKGYFLLRFLAKRLGDETYFSFLRKFVHTFHGQLILSQDF 626

  Fly   460 WDLLQLQVDRNGRLGKGLNITRIMKCWLGQPGYP 493
            ..:|...:....||  .|::..|.:.||...|.|
Human   627 LQMLLENIPEEKRL--ELSVENIYQDWLESSGIP 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2111NP_572644.1 Peptidase_M1 25..421 CDD:279741 53/350 (15%)
M1_APN_2 33..493 CDD:189008 71/422 (17%)
ERAP1_C 579..897 CDD:288671
AOPEPNP_001372995.1 GluZincin <244..652 CDD:417498 68/416 (16%)
Nucleolar localization signal. /evidence=ECO:0000250|UniProtKB:Q8BXQ6 689..699
Leuk-A4-hydro_C 721..>771 CDD:401171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.